3kpb/2/1:C/1:D

Sequences
>3kpb-a2-m1-cC (length=119) [Search sequence]
TLVKDILSKPPITAHSNISIMEAAKILIKHNINHLPIVDEHGKLVGIITSWDIAKALAQN
KKTIEEIMTRNVITAHEDEPVDHVAIKMSKYNISGVPVVDDYRRVVGIVTSEDISRLFG
>3kpb-a2-m1-cD (length=119) [Search sequence]
TLVKDILSKPPITAHSNISIMEAAKILIKHNINHLPIVDEHGKLVGIITSWDIAKALAQN
KKTIEEIMTRNVITAHEDEPVDHVAIKMSKYNISGVPVVDDYRRVVGIVTSEDISRLFG
Structure information
PDB ID 3kpb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the CBS domain pair of protein MJ0100 in complex with 5 -methylthioadenosine and S-adenosyl-L-methionine.
Assembly ID 2
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
PubMed citation 20026078
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q57564 Q57564
Species 2190 (Methanocaldococcus jannaschii) 2190 (Methanocaldococcus jannaschii)
Function annotation BioLiP:3kpbC BioLiP:3kpbD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3kpb-a2-m1-cC_3kpb-a2-m1-cD.pdb.gz
Full biological assembly
Download: 3kpb-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3kpc/1/1:A/2:A 3kpd/1/1:A/2:A 3kpd/2/1:C/1:B 3kpd/3/1:D/3:D
  • [Back to Home]