3ktb/1/4:C/1:A

Sequences
>3ktb-a1-m4-cC (length=100) [Search sequence]
AKKIEIFDPACCPTGLCGTNINPELRIAVVIESLKKQGIIVTRHNLRDEPQVYVSNKTVN
DFLQKHGADALPITLVDGEIAVSQTYPTTKQSEWTGVNLD
>3ktb-a1-m1-cA (length=102) [Search sequence]
SNAKKIEIFDPACCPTGLCGTNINPELRIAVVIESLKKQGIIVTRHNLRDEPQVYVSNKT
VNDFLQKHGADALPITLVDGEIAVSQTYPTTKQSEWTGVNLD
Structure information
PDB ID 3ktb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Arsenical Resistance Operon Trans-acting Repressor from Bacteroides vulgatus ATCC 8482
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 1
Chain ID C A
UniProt accession A6L7X2 A6L7X2
Species 435590 (Phocaeicola vulgatus ATCC 8482) 435590 (Phocaeicola vulgatus ATCC 8482)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ktb-a1-m4-cC_3ktb-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3ktb-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ktb/1/1:C/3:A 3ktb/1/2:C/4:A 3ktb/1/3:C/2:A
Other dimers with similar sequences but different poses
  • 3ktb/2/1:C/1:D 3ktb/1/1:B/1:A 3ktb/1/1:C/1:D 3ktb/1/2:B/2:A 3ktb/1/2:C/2:D 3ktb/1/3:B/3:A 3ktb/1/3:C/3:D 3ktb/1/4:B/4:A 3ktb/1/4:C/4:D 3ktb/2/1:B/1:A
  • 3ktb/2/1:B/1:D 3ktb/1/1:B/1:D 3ktb/1/2:B/2:D 3ktb/1/3:B/3:D 3ktb/1/4:B/4:D
  • 3ktb/1/2:D/4:D 3ktb/1/1:D/3:D 3ktb/1/1:D/4:D 3ktb/1/2:D/3:D
  • [Back to Home]