3kvp/1/1:E/1:C

Sequences
>3kvp-a1-m1-cE (length=42) [Search sequence]
QPTSFPLEHNHFGVEDGYIKIYEYNESRNEVKLKKEYADDEL
>3kvp-a1-m1-cC (length=44) [Search sequence]
QPTSFPLEHNHFGVEDGYIKIYEYNESRNEVKLKKEYADDELEL
Structure information
PDB ID 3kvp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Uncharacterized protein ymzC Precursor from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR378A
Assembly ID 1
Resolution 2.404Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E C
UniProt accession O31797 O31797
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3kvp-a1-m1-cE_3kvp-a1-m1-cC.pdb.gz
Full biological assembly
Download: 3kvp-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3kvp/1/1:C/1:D 3kvp/1/1:F/1:A 3kvp/1/1:F/1:B

[Back to Home]