3kx8/3/1:E/1:F

Sequences
>3kx8-a3-m1-cE (length=129) [Search sequence]
RVGERFTHDFVVPPHKTVRHLYPESPEFAEFPEVFATGFVGLEWACVRAAPYLEPGEGSL
GTAICVTHTAATPPGLTVTVTAELRSVEGRRLSWRVSAHDGVDEIGSGTHERAVIHLEKF
NAKVRQKTP
>3kx8-a3-m1-cF (length=129) [Search sequence]
RVGERFTHDFVVPPHKTVRHLYPESPEFAEFPEVFATGFVGLEWACVRAAPYLEPGEGSL
GTAICVTHTAATPPGLTVTVTAELRSVEGRRLSWRVSAHDGVDEIGSGTHERAVIHLEKF
NAKVRQKTP
Structure information
PDB ID 3kx8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis of the activity and substrate specificity of the fluoroacetyl-CoA thioesterase FlK
Assembly ID 3
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 130
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession Q1EMV2 Q1EMV2
Species 29303 (Streptantibioticus cattleyicolor) 29303 (Streptantibioticus cattleyicolor)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3kx8-a3-m1-cE_3kx8-a3-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3kx8-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3kuv/1/1:A/1:B 3kuw/1/1:A/1:B 3kv7/1/1:A/1:B 3kv8/1/1:A/1:B 3kvi/1/1:A/1:B 3kvu/1/1:A/1:B 3kvu/2/1:C/1:D 3kvz/1/1:A/1:B 3kvz/2/1:C/1:D 3kvz/3/1:E/1:F 3kvz/4/1:G/1:H 3kw1/1/1:A/1:B 3kw1/2/1:C/1:D 3kw1/3/1:E/1:F 3kw1/4/1:G/1:H 3kx7/1/1:A/1:B 3kx8/1/1:A/1:B 3kx8/2/1:C/1:D 3kx8/4/1:G/1:H 3p2q/1/1:A/1:B 3p2r/1/1:A/1:B 3p2s/1/1:A/1:B 3p3f/1/1:B/1:A 3p3f/2/1:D/1:C 3p3f/3/1:E/1:F 3p3i/1/1:B/1:A 3p3i/2/1:D/1:C 3p3i/3/1:E/1:F

[Back to Home]