3kye/2/1:C/1:D

Sequences

>3kye-a2-m1-cC (length=115) [Search sequence]

SDLDWLSGLVQRVPHTTSAVLLSCDGLVKSVHGLDPDSADHAALASGLYSLGRSAGIRFG DGGDVRQVVVELDSTLLFVSTAGSGTCLAVLAGREADAAVLGYEALVKSVRPYLT

>3kye-a2-m1-cD (length=115) [Search sequence]

VSDLDWLSGLVQRVPHTTSAVLLSCDGLVKSVHGLDPDSADHAALASGLYSLGRSAGIRF GDGGDVRQVVVELDSTLLFVSTAGSGTCLAVLAGREADAAVLGYEALVKSVRPYL

Structure information

PDB ID	3kye (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Roadblock/LC7 Domain from Streptomyces avermitilis
Assembly ID	2
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	108
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q82MM8	Q82MM8
Species	227882 (Streptomyces avermitilis MA-4680 = NBRC 14893)	227882 (Streptomyces avermitilis MA-4680 = NBRC 14893)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3kye-a2-m1-cC_3kye-a2-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3kye-assembly2.cif.gz

Similar dimers