3l32/1/1:A/1:B

Sequences
>3l32-a1-m1-cA (length=44) [Search sequence]
NLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF
>3l32-a1-m1-cB (length=45) [Search sequence]
MNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF
Structure information
PDB ID 3l32 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the dimerisation domain of the rabies virus phosphoprotein
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q0GBY3 Q0GBY3
Species 445791 (Rabies virus China/MRV) 445791 (Rabies virus China/MRV)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3l32-a1-m1-cA_3l32-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3l32-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 8fuq/1/1:A/1:B 8fuq/2/1:D/1:C 8fuq/3/1:F/1:E

[Back to Home]