3l34/1/1:A/1:B

Sequences

>3l34-a1-m1-cA (length=118) [Search sequence]

AQEQRSHHYATIEVSQQLRQLLGDQLVILLRETPDGQALERSQNDFRRVLEQGRANTVDS AEQAALDGVRDAYLQLQAHTPALLEAPADNDGFSEAFNGLRLRLQDLQQLALAGISEA

>3l34-a1-m1-cB (length=122) [Search sequence]

SNAQEQRSHHYATIEVSQQLRQLLGDQLVILLRETPDGQALERSQNDFRRVLEQGRANTV DSAEQAALDGVRDAYLQLQAHTPALLEAPADNDGFSEAFNGLRLRLQDLQQLALAGISEA ET

Structure information

PDB ID	3l34 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of a two-component sensor domain (2nd form) from Pseudomonas aeruginosa PA01
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	154
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9HT87	Q9HT87
Species	208964 (Pseudomonas aeruginosa PAO1)	208964 (Pseudomonas aeruginosa PAO1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3l34-a1-m1-cA_3l34-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3l34-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3kkb/1/1:A/1:B 3l34/2/1:D/1:C 3l34/3/1:F/1:E 3l34/4/1:H/1:G 3n24/2/1:D/1:C 4lle/2/1:C/1:D