3l7p/1/1:B/1:F

Sequences
>3l7p-a1-m1-cB (length=88) [Search sequence]
MKKIEAIIRSDKLEDLKAALVQSGFIKGMTISQVLGFGTLLAKVKVEIVAHDAAVEEMIT
TISQAVKTGEVGDGKIFVSPVDEIVRIR
>3l7p-a1-m1-cF (length=88) [Search sequence]
SMKKIEAIIRSDKLEDLKAALVQSGFIKGMTISQVLGFGTLLAKVKVEIVAHDAAVEEMI
TTISQAVKTGEVGDGKIFVSPVDEIVRI
Structure information
PDB ID 3l7p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SMU.1657c, Putative nitrogen regulatory protein PII from streptococcus mutans
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 72
Sequence identity between the two chains 0.989
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B F
UniProt accession Q8DSV2 Q8DSV2
Species 1309 (Streptococcus mutans) 1309 (Streptococcus mutans)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3l7p-a1-m1-cB_3l7p-a1-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3l7p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3l7p/1/1:A/1:C 3l7p/1/1:A/1:D
Other dimers with similar sequences but different poses
  • 3l7p/1/1:F/1:C 3l7p/1/1:A/1:B 3l7p/1/1:E/1:D
  • [Back to Home]