3l7p/1/1:F/1:C

Sequences

>3l7p-a1-m1-cF (length=88) [Search sequence]

SMKKIEAIIRSDKLEDLKAALVQSGFIKGMTISQVLGFGTLLAKVKVEIVAHDAAVEEMI TTISQAVKTGEVGDGKIFVSPVDEIVRI

>3l7p-a1-m1-cC (length=91) [Search sequence]

SMKKIEAIIRSDKLEDLKAALVQSGFIKGMTISQVLGFGNTPTLLAKVKVEIVAHDAAVE EMITTISQAVKTGEGDGKIFVSPVDEIVRIR

Structure information

PDB ID	3l7p (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of SMU.1657c, Putative nitrogen regulatory protein PII from streptococcus mutans
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	C
UniProt accession	Q8DSV2	Q8DSV2
Species	1309 (Streptococcus mutans)	1309 (Streptococcus mutans)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3l7p-a1-m1-cF_3l7p-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3l7p-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3l7p/1/1:A/1:B 3l7p/1/1:E/1:D
Other dimers with similar sequences but different poses	3l7p/1/1:B/1:F 3l7p/1/1:A/1:C 3l7p/1/1:A/1:D