3lay/1/1:A/1:B

Sequences

>3lay-a1-m1-cA (length=79) [Search sequence]

LTTEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQ KLDEQRVKRDVAMAQAGIP

>3lay-a1-m1-cB (length=79) [Search sequence]

LTTEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQ KLDEQRVKRDVAMAQAGIP

Structure information

PDB ID	3lay (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Alpha-Helical barrel formed by the decamer of the zinc resistance-associated protein (STM4172) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
Assembly ID	1
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9L9I0	Q9L9I0
Species	90371 (Salmonella enterica subsp. enterica serovar Typhimurium)	90371 (Salmonella enterica subsp. enterica serovar Typhimurium)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3lay-a1-m1-cA_3lay-a1-m1-cB.pdb.gz

Full biological assembly Download: 3lay-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3lay/1/1:D/1:C 3lay/1/1:E/1:F 3lay/1/1:G/1:H 3lay/1/1:I/1:J
Other dimers with similar sequences but different poses	3lay/1/1:G/1:F 3lay/1/1:A/1:J 3lay/1/1:B/1:C 3lay/1/1:D/1:E 3lay/1/1:I/1:H