3lay/1/1:G/1:F

Sequences
>3lay-a1-m1-cG (length=77) [Search sequence]
TEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQKL
DEQRVKRDVAMAQAGIP
>3lay-a1-m1-cF (length=78) [Search sequence]
LTTEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQ
KLDEQRVKRDVAMAQAGI
Structure information
PDB ID 3lay (database links: RCSB PDB PDBe PDBj PDBsum)
Title Alpha-Helical barrel formed by the decamer of the zinc resistance-associated protein (STM4172) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 0.987
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G F
UniProt accession Q9L9I0 Q9L9I0
Species 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) 90371 (Salmonella enterica subsp. enterica serovar Typhimurium)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3lay-a1-m1-cG_3lay-a1-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3lay-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3lay/1/1:A/1:J 3lay/1/1:B/1:C 3lay/1/1:D/1:E 3lay/1/1:I/1:H
Other dimers with similar sequences but different poses
  • 3lay/1/1:A/1:B 3lay/1/1:D/1:C 3lay/1/1:E/1:F 3lay/1/1:G/1:H 3lay/1/1:I/1:J
  • [Back to Home]