3lcz/1/3:A/3:D

Sequences
>3lcz-a1-m3-cA (length=53) [Search sequence]
MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE
>3lcz-a1-m3-cD (length=53) [Search sequence]
MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE
Structure information
PDB ID 3lcz (database links: RCSB PDB PDBe PDBj PDBsum)
Title B.licheniformis Anti-TRAP can assemble into two types of dodecameric particles with the same symmetry but inverted orientation of trimers
Assembly ID 1
Resolution 2.06Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
PubMed citation 20138150
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A D
UniProt accession Q65NU7 Q65NU7
Species 279010 (Bacillus licheniformis DSM 13 = ATCC 14580) 279010 (Bacillus licheniformis DSM 13 = ATCC 14580)
Function annotation BioLiP:3lczA BioLiP:3lczD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3lcz-a1-m3-cA_3lcz-a1-m3-cD.pdb.gz
Full biological assembly
Download: 3lcz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3lcz/1/1:A/1:D 3lcz/1/1:B/3:C 3lcz/1/1:C/2:B 3lcz/1/2:A/2:D 3lcz/1/2:C/3:B
Other dimers with similar sequences but different poses
  • 3ld0/3/1:2/1:4 3lcz/1/1:A/1:B 3lcz/1/1:A/1:C 3lcz/1/1:B/1:C 3lcz/1/1:D/2:D 3lcz/1/1:D/3:D 3lcz/1/2:A/2:B 3lcz/1/2:A/2:C 3lcz/1/2:B/2:C 3lcz/1/2:D/3:D 3lcz/1/3:A/3:B 3lcz/1/3:A/3:C 3lcz/1/3:B/3:C 3ld0/1/1:A/1:B 3ld0/1/1:A/1:C 3ld0/1/1:B/1:C 3ld0/1/1:D/1:E 3ld0/1/1:D/1:F 3ld0/1/1:E/1:F 3ld0/1/1:G/1:H 3ld0/1/1:G/1:I 3ld0/1/1:H/1:I 3ld0/1/1:J/1:K 3ld0/1/1:J/1:L 3ld0/1/1:K/1:L 3ld0/2/1:M/1:O 3ld0/2/1:N/1:M 3ld0/2/1:N/1:O 3ld0/2/1:P/1:Q 3ld0/2/1:P/1:R 3ld0/2/1:Q/1:R 3ld0/2/1:S/1:T 3ld0/2/1:S/1:U 3ld0/2/1:T/1:U 3ld0/2/1:V/1:W 3ld0/2/1:V/1:X 3ld0/2/1:W/1:X 3ld0/3/1:1/1:Y 3ld0/3/1:2/1:3 3ld0/3/1:4/1:3 3ld0/3/1:5/1:6 3ld0/3/1:5/1:7 3ld0/3/1:6/1:7 3ld0/3/1:8/1:9 3ld0/3/1:8/1:a 3ld0/3/1:9/1:a 3ld0/3/1:Z/1:1 3ld0/3/1:Z/1:Y 3ld0/4/1:b/1:c 3ld0/4/1:b/1:d 3ld0/4/1:c/1:d 3ld0/4/1:e/1:f 3ld0/4/1:e/1:g 3ld0/4/1:f/1:g 3ld0/4/1:h/1:i 3ld0/4/1:h/1:j 3ld0/4/1:i/1:j 3ld0/4/1:k/1:m 3ld0/4/1:l/1:k 3ld0/4/1:l/1:m
  • 3ld0/1/1:B/1:D 3ld0/1/1:A/1:J 3ld0/1/1:C/1:I 3ld0/1/1:E/1:L 3ld0/1/1:G/1:F 3ld0/1/1:H/1:K 3ld0/2/1:M/1:V 3ld0/2/1:N/1:P 3ld0/2/1:O/1:U 3ld0/2/1:Q/1:X 3ld0/2/1:R/1:S 3ld0/2/1:T/1:W 3ld0/3/1:1/1:7 3ld0/3/1:2/1:Z 3ld0/3/1:3/1:a 3ld0/3/1:4/1:5 3ld0/3/1:6/1:9 3ld0/3/1:8/1:Y 3ld0/4/1:b/1:k 3ld0/4/1:c/1:e 3ld0/4/1:d/1:j 3ld0/4/1:f/1:m 3ld0/4/1:g/1:h 3ld0/4/1:l/1:i
  • [Back to Home]