3ld0/3/1:2/1:4

Sequences
>3ld0-a3-m1-c2 (length=52) [Search sequence]
MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIH
>3ld0-a3-m1-c4 (length=52) [Search sequence]
MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIH
Structure information
PDB ID 3ld0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of B.licheniformis Anti-TRAP protein, an antagonist of TRAP-RNA interactions
Assembly ID 3
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
PubMed citation 20138150
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID 2 4
UniProt accession Q65NU7 Q65NU7
Species 279010 (Bacillus licheniformis DSM 13 = ATCC 14580) 279010 (Bacillus licheniformis DSM 13 = ATCC 14580)
Function annotation BioLiP:3ld02 BioLiP:3ld04
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ld0-a3-m1-c2_3ld0-a3-m1-c4.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3ld0-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3lcz/1/1:A/1:B 3lcz/1/1:A/1:C 3lcz/1/1:B/1:C 3lcz/1/1:D/2:D 3lcz/1/1:D/3:D 3lcz/1/2:A/2:B 3lcz/1/2:A/2:C 3lcz/1/2:B/2:C 3lcz/1/2:D/3:D 3lcz/1/3:A/3:B 3lcz/1/3:A/3:C 3lcz/1/3:B/3:C 3ld0/1/1:A/1:B 3ld0/1/1:A/1:C 3ld0/1/1:B/1:C 3ld0/1/1:D/1:E 3ld0/1/1:D/1:F 3ld0/1/1:E/1:F 3ld0/1/1:G/1:H 3ld0/1/1:G/1:I 3ld0/1/1:H/1:I 3ld0/1/1:J/1:K 3ld0/1/1:J/1:L 3ld0/1/1:K/1:L 3ld0/2/1:M/1:O 3ld0/2/1:N/1:M 3ld0/2/1:N/1:O 3ld0/2/1:P/1:Q 3ld0/2/1:P/1:R 3ld0/2/1:Q/1:R 3ld0/2/1:S/1:T 3ld0/2/1:S/1:U 3ld0/2/1:T/1:U 3ld0/2/1:V/1:W 3ld0/2/1:V/1:X 3ld0/2/1:W/1:X 3ld0/3/1:1/1:Y 3ld0/3/1:2/1:3 3ld0/3/1:4/1:3 3ld0/3/1:5/1:6 3ld0/3/1:5/1:7 3ld0/3/1:6/1:7 3ld0/3/1:8/1:9 3ld0/3/1:8/1:a 3ld0/3/1:9/1:a 3ld0/3/1:Z/1:1 3ld0/3/1:Z/1:Y 3ld0/4/1:b/1:c 3ld0/4/1:b/1:d 3ld0/4/1:c/1:d 3ld0/4/1:e/1:f 3ld0/4/1:e/1:g 3ld0/4/1:f/1:g 3ld0/4/1:h/1:i 3ld0/4/1:h/1:j 3ld0/4/1:i/1:j 3ld0/4/1:k/1:m 3ld0/4/1:l/1:k 3ld0/4/1:l/1:m
Other dimers with similar sequences but different poses
  • 3lcz/1/3:A/3:D 3lcz/1/1:A/1:D 3lcz/1/1:B/3:C 3lcz/1/1:C/2:B 3lcz/1/2:A/2:D 3lcz/1/2:C/3:B
  • 3ld0/1/1:B/1:D 3ld0/1/1:A/1:J 3ld0/1/1:C/1:I 3ld0/1/1:E/1:L 3ld0/1/1:G/1:F 3ld0/1/1:H/1:K 3ld0/2/1:M/1:V 3ld0/2/1:N/1:P 3ld0/2/1:O/1:U 3ld0/2/1:Q/1:X 3ld0/2/1:R/1:S 3ld0/2/1:T/1:W 3ld0/3/1:1/1:7 3ld0/3/1:2/1:Z 3ld0/3/1:3/1:a 3ld0/3/1:4/1:5 3ld0/3/1:6/1:9 3ld0/3/1:8/1:Y 3ld0/4/1:b/1:k 3ld0/4/1:c/1:e 3ld0/4/1:d/1:j 3ld0/4/1:f/1:m 3ld0/4/1:g/1:h 3ld0/4/1:l/1:i
    		•

    [Back to Home]