3le4/1/1:A/2:A

Sequences

>3le4-a1-m1-cA (length=55) [Search sequence]

PPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPC

>3le4-a1-m2-cA (length=55) [Search sequence]

PPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPC

Structure information

PDB ID	3le4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the DGCR8 dimerization domain
Assembly ID	1
Resolution	1.701Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	88
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	Q8WYQ5	Q8WYQ5
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3le4-a1-m1-cA_3le4-a1-m2-cA.pdb.gz

Full biological assembly Download: 3le4-assembly1.cif.gz

Similar dimers