3lf0/1/1:C/1:B

Sequences

>3lf0-a1-m1-cC (length=101) [Search sequence]

HMKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRYSVDFVPKVRIEVVVDDSIVD KVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDAL

>3lf0-a1-m1-cB (length=112) [Search sequence]

HMKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQGHTEVYRGAEYSVDFVPKVR IEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDAL

Structure information

PDB ID	3lf0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein
Assembly ID	1
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	78
Sequence identity between the two chains	1.0
PubMed citation	20521335

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	P9WN31	P9WN31
Species	1773 (Mycobacterium tuberculosis)	1773 (Mycobacterium tuberculosis)
Function annotation	BioLiP:3lf0C	BioLiP:3lf0B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3lf0-a1-m1-cC_3lf0-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3lf0-assembly1.cif.gz