3lfr/1/1:A/1:B

Sequences

>3lfr-a1-m1-cA (length=120) [Search sequence]

LQVRDIVPRSQISIKATQTPREFLPAVIDAAHSRYPVIGESHDDVLGVLLAKDLLPLILK ADGDSDDVKKLLRPATFVPESKRLNVLLREFRANHNHAIVIDEYGGVAGLVTIEDVLEQI

>3lfr-a1-m1-cB (length=125) [Search sequence]

ADLQVRDIVPRSQISIKATQTPREFLPAVIDAAHSRYPVIGESHDDVLGVLLAKDLLPLI LKAGDSDVKKLLRPATFVPESKRLNVLLREFRANHNHAIVIDEYGGVAGLVTIEDVLEQI VGDIE

Structure information

PDB ID	3lfr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The Crystal Structure of a CBS Domain from a Putative Metal Ion Transporter Bound to AMP from Pseudomonas syringae to 1.55A
Assembly ID	1
Resolution	1.53Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	66
Sequence identity between the two chains	0.983
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q87VX8	Q87VX8
Species	223283 (Pseudomonas syringae pv. tomato str. DC3000)	223283 (Pseudomonas syringae pv. tomato str. DC3000)
Function annotation	BioLiP:3lfrA	BioLiP:3lfrB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3lfr-a1-m1-cA_3lfr-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3lfr-assembly1.cif.gz