3lga/1/1:C/1:D

Sequences

>3lga-a1-m1-cC (length=253) [Search sequence]

MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILR
PRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGR
VVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHA
AKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTA
LVHTGYITFARRI

>3lga-a1-m1-cD (length=253) [Search sequence]

Structure information

PDB ID	3lga (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of P. abyssi tRNA m1A58 methyltransferase in complex with S-adenosyl-L-homocysteine
Assembly ID	1
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	153
Sequence identity between the two chains	1.0
PubMed citation	20483913

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q9V1J7	Q9V1J7
Species	272844 (Pyrococcus abyssi GE5)	272844 (Pyrococcus abyssi GE5)
Function annotation	BioLiP:3lgaC	BioLiP:3lgaD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3lga-a1-m1-cC_3lga-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3lga-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3lga/1/1:A/1:B 3lhd/1/1:A/1:B 3lhd/1/1:C/1:D 3mb5/1/1:A/4:A 3mb5/1/2:A/3:A
Other dimers with similar sequences but different poses	3mb5/1/3:A/4:A 3lga/1/1:A/1:C 3lga/1/1:B/1:D 3lhd/1/1:A/1:C 3lhd/1/1:B/1:D 3mb5/1/1:A/2:A