3ll9/1/1:A/1:B

Sequences

>3ll9-a1-m1-cA (length=238) [Search sequence]

HIILKLGGSVITRKDSEEPAIDRDNLERIASEIGNASPSSLIVHGAGSFGHPFAGEYRIG
SEIENEEDLRRRRFGFALTQNWVKKLNSHVCDALLAEGIPAVSQPSAFIRAHAGRISHAD
ISLIRSYLEEGVPVVYGDVVLDSDRRLKFSVISGDQLINHFSLRLPERVILGTDVDGVYT
RNPKKHPDARLLDVIGVGKIRELLLLAEKGVESEIINAAVPGNIERALLGEEVRGTRI

>3ll9-a1-m1-cB (length=243) [Search sequence]

Structure information

PDB ID	3ll9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray structures of isopentenyl phosphate kinase
Assembly ID	1
Resolution	2.148Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	98
Sequence identity between the two chains	1.0
PubMed citation	20402538

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O26153	O26153
Species	145262 (Methanothermobacter thermautotrophicus)	145262 (Methanothermobacter thermautotrophicus)
Function annotation	BioLiP:3ll9A	BioLiP:3ll9B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3ll9-a1-m1-cA_3ll9-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3ll9-assembly1.cif.gz