3lny/1/3:A/6:A

Sequences
>3lny-a1-m3-cA (length=94) [Search sequence]
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLA
VNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
>3lny-a1-m6-cA (length=94) [Search sequence]
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLA
VNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
Structure information
PDB ID 3lny (database links: RCSB PDB PDBe PDBj PDBsum)
Title Second PDZ domain from human PTP1E in complex with RA-GEF2 peptide
Assembly ID 1
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
PubMed citation 20839809
Chain information
Chain 1 Chain 2
Model ID 3 6
Chain ID A A
UniProt accession Q12923 Q12923
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3lnyA BioLiP:3lnyA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3lny-a1-m3-cA_3lny-a1-m6-cA.pdb.gz
Full biological assembly
Download: 3lny-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3lnx/1/1:A/1:B 3lnx/1/1:C/1:E 3lnx/1/1:D/1:F 3lny/1/1:A/5:A 3lny/1/2:A/4:A
Other dimers with similar sequences but different poses
  • 3lny/1/5:A/6:A 3lnx/1/1:A/1:E 3lnx/1/1:A/1:F 3lnx/1/1:B/1:C 3lnx/1/1:B/1:D 3lnx/1/1:C/1:D 3lnx/1/1:E/1:F 3lny/1/1:A/2:A 3lny/1/1:A/3:A 3lny/1/2:A/3:A 3lny/1/4:A/5:A 3lny/1/4:A/6:A
  • [Back to Home]