3lny/1/5:A/6:A

Sequences

>3lny-a1-m5-cA (length=94) [Search sequence]

PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLA VNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS

>3lny-a1-m6-cA (length=94) [Search sequence]

PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLA VNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS

Structure information

PDB ID	3lny (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Second PDZ domain from human PTP1E in complex with RA-GEF2 peptide
Assembly ID	1
Resolution	1.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0
PubMed citation	20839809

Chain information

	Chain 1	Chain 2
Model ID	5	6
Chain ID	A	A
UniProt accession	Q12923	Q12923
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3lnyA	BioLiP:3lnyA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3lny-a1-m5-cA_3lny-a1-m6-cA.pdb.gz

Full biological assembly Download: 3lny-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3lnx/1/1:A/1:E 3lnx/1/1:A/1:F 3lnx/1/1:B/1:C 3lnx/1/1:B/1:D 3lnx/1/1:C/1:D 3lnx/1/1:E/1:F 3lny/1/1:A/2:A 3lny/1/1:A/3:A 3lny/1/2:A/3:A 3lny/1/4:A/5:A 3lny/1/4:A/6:A
Other dimers with similar sequences but different poses	3lny/1/3:A/6:A 3lnx/1/1:A/1:B 3lnx/1/1:C/1:E 3lnx/1/1:D/1:F 3lny/1/1:A/5:A 3lny/1/2:A/4:A