3lo3/1/1:A/1:B

Sequences
>3lo3-a1-m1-cA (length=93) [Search sequence]
SNATAYIIVGLTPKDAEKLQQYGARVASTLAKYSGEVLVKGSVEQLHGKFEHKAQVILEF
PSREDAYNWYHSEEYQALISTRDLGDSQFQLIG
>3lo3-a1-m1-cB (length=93) [Search sequence]
SNATAYIIVGLTPKDAEKLQQYGARVASTLAKYSGEVLVKGSVEQLHGKFEHKAQVILEF
PSREDAYNWYHSEEYQALISTRDLGDSQFQLIG
Structure information
PDB ID 3lo3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of a conserved functionally unknown protein from Colwellia psychrerythraea 34H.
Assembly ID 1
Resolution 2.383Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 81
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q484V4 Q484V4
Species 167879 (Colwellia psychrerythraea 34H) 167879 (Colwellia psychrerythraea 34H)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3lo3-a1-m1-cA_3lo3-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3lo3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3lo3/10/1:U/1:V 3lo3/11/1:W/1:X 3lo3/12/1:Y/1:Z 3lo3/13/1:a/1:b 3lo3/14/1:O/1:P 3lo3/2/1:C/1:D 3lo3/3/1:E/1:F 3lo3/4/1:G/1:H 3lo3/5/1:I/1:J 3lo3/6/1:K/1:L 3lo3/7/1:M/1:N 3lo3/8/1:Q/1:R 3lo3/9/1:S/1:T

[Back to Home]