3lp9/2/1:B/1:D

Sequences

>3lp9-a2-m1-cB (length=227) [Search sequence]

TKPGYINAAFRSSKNNEAYFFINDKYVLLDYAPGSSRDKVLYGPTPVRDGFKSLNQTIFG
SYGIDCSFDTENNEAFIFYENFCALIDYAPHSKKDKIILGPKKIADVFPFFEGTVFESGI
DAAYRSTRGKEVYLFKGDQYARIDYGSNSMVNKEIKSISSGYPCFRNTIFESGADAAFAS
HKTNEVYFFKDDHYARVKVTPXXKLXIMDGVREIVDYWPSLKDIVPL

>3lp9-a2-m1-cD (length=227) [Search sequence]

Structure information

PDB ID	3lp9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of LS24, A Seed Albumin from Lathyrus sativus
Assembly ID	2
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	20147493

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	D4AEP7	D4AEP7
Species	3860 (Lathyrus sativus)	3860 (Lathyrus sativus)
Function annotation	BioLiP:3lp9B	BioLiP:3lp9D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3lp9-a2-m1-cB_3lp9-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3lp9-assembly2.cif.gz

Similar dimers