3lph/2/1:D/1:C

Sequences

>3lph-a2-m1-cD (length=57) [Search sequence]

SDEDSLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIRSTYL

>3lph-a2-m1-cC (length=58) [Search sequence]

SDEDSLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIRSTYLG

Structure information

PDB ID	3lph (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the HIV-1 Rev dimer
Assembly ID	2
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	32
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P69718	P69718
Species	11707 (Human immunodeficiency virus type 1 (HXB3 ISOLATE))	11707 (Human immunodeficiency virus type 1 (HXB3 ISOLATE))

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3lph-a2-m1-cD_3lph-a2-m1-cC.pdb.gz

Full biological assembly Download: 3lph-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

4pmi/2/6:C/6:B 4pmi/1/1:C/1:B 4pmi/1/2:C/2:B 4pmi/1/3:C/3:B 4pmi/2/1:C/1:B 4pmi/2/2:C/2:B 4pmi/2/3:C/3:B 4pmi/2/4:C/4:B 4pmi/2/5:C/5:B