3lrq/2/1:B/1:C

Sequences

>3lrq-a2-m1-cB (length=78) [Search sequence]

HDEQSVESIAEVFRCFICEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLR ELVNCRWAEEVTQQLDTL

>3lrq-a2-m1-cC (length=80) [Search sequence]

DEQSVESIAEVFRCFICEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRE LVNCRWAEEVTQQLDTLQLC

Structure information

PDB ID	3lrq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the U-box domain of human ubiquitin-protein ligase (E3), NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR4604D.
Assembly ID	2
Resolution	2.292Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	0.987
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	O94972	O94972
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3lrqB	BioLiP:3lrqC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3lrq-a2-m1-cB_3lrq-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3lrq-assembly2.cif.gz

Similar dimers