3lrq/2/1:B/1:C

Sequences
>3lrq-a2-m1-cB (length=78) [Search sequence]
HDEQSVESIAEVFRCFICEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLR
ELVNCRWAEEVTQQLDTL
>3lrq-a2-m1-cC (length=80) [Search sequence]
DEQSVESIAEVFRCFICEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRE
LVNCRWAEEVTQQLDTLQLC
Structure information
PDB ID 3lrq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the U-box domain of human ubiquitin-protein ligase (E3), NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR4604D.
Assembly ID 2
Resolution 2.292Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 0.987
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession O94972 O94972
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3lrqB BioLiP:3lrqC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3lrq-a2-m1-cB_3lrq-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3lrq-assembly2.cif.gz
Similar dimers

[Back to Home]