3lub/2/1:G/1:L

Sequences

>3lub-a2-m1-cG (length=246) [Search sequence]

NKEVDLSVSCLGKVKELKYDVIILPWGATEPHNLHLPYLTDCILPHDIAVEAAELALSRS
GVRCVPPVPFGAHNPGQRELPFCIHTRYATQQAILEDIVSSLHVQGFRKLLILSGHGGNN
FKGIRDLAFEYPDFLIAAANWFEVVSPKGYFEAEIDDHAGESETSVHYHPELVNLAEAGD
GESKPFAIASLNEKVAWVPRHWDKATVDSGVGNPKKATAEKGERYVKPIVEKLAGLFEEA
QHDLYE

>3lub-a2-m1-cL (length=246) [Search sequence]

Structure information

PDB ID	3lub (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Putative creatinine amidohydrolase (YP_211512.1) from Bacteroides fragilis NCTC 9343 at 2.11 A resolution
Assembly ID	2
Resolution	2.11Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	148
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	L
UniProt accession	Q5LE76	Q5LE76
Species	272559 (Bacteroides fragilis NCTC 9343)	272559 (Bacteroides fragilis NCTC 9343)
Function annotation	BioLiP:3lubG	BioLiP:3lubL

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3lub-a2-m1-cG_3lub-a2-m1-cL.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3lub-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3lub/1/1:A/1:F 3lub/1/1:B/1:C 3lub/1/1:D/1:E 3lub/2/1:H/1:I 3lub/2/1:J/1:K
Other dimers with similar sequences but different poses	3lub/2/1:K/1:L 3lub/1/1:A/1:B 3lub/1/1:C/1:D 3lub/1/1:E/1:F 3lub/2/1:G/1:H 3lub/2/1:I/1:J