3lul/1/1:A/1:B

Sequences

>3lul-a1-m1-cA (length=263) [Search sequence]

PTRVIEDKTPSFGIDDRIFLGEGLFETIRVNSSKPSFAYHWERLGNSARQLGIPFEISFD
DWFEHLIQKIQKDNLYHGGIKAILSGGPASRGLAERGQVSQLIFQTFNYSIQKHPVRLIS
INWLRDKANPLYQLSVNYLEAIIAQRQAIAVGADDALFFNTENHVTETTCANLFLIENNI
LYTPRVEDGILPGITRARLISHCQQHKSVQEISLTKKRIEDADAVFLTNSLQGIRRVLSL
DNIIFEVNHPIIDKLIFLLNQDE

>3lul-a1-m1-cB (length=264) [Search sequence]

Structure information

PDB ID	3lul (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Putative 4-amino-4-deoxychorismate lyase. (YP_094631.1) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 1.78 A resolution
Assembly ID	1
Resolution	1.78Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	135
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q5ZXY5	Q5ZXY5
Species	272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)	272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3lul-a1-m1-cA_3lul-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3lul-assembly1.cif.gz