3luq/2/1:B/1:C

Sequences

>3luq-a2-m1-cB (length=111) [Search sequence]

SDERLRLFTEHAPAALAFDRERYLAVSRRWREDYGLGDGDILGSHYDIFPEIGEEWKSVH RRGLAGEVIRVEEDCFVRADGRTQWLRWEVRPWYEGEGRVGGVVIFTEDIT

>3luq-a2-m1-cC (length=111) [Search sequence]

SDERLRLFTEHAPAALAFDRERYLAVSRRWREDYGLGDGDILGSHYDIFPEIGEEWKSVH RRGLAGEVIRVEEDCFVRADGRTQWLRWEVRPWYEGEGRVGGVVIFTEDIT

Structure information

PDB ID	3luq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The Crystal Structure of a PAS Domain from a Sensory Box Histidine Kinase Regulator from Geobacter sulfurreducens to 2.5A
Assembly ID	2
Resolution	2.49Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q74DA3	Q74DA3
Species	243231 (Geobacter sulfurreducens PCA)	243231 (Geobacter sulfurreducens PCA)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3luq-a2-m1-cB_3luq-a2-m1-cC.pdb.gz

Full biological assembly Download: 3luq-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3luq/1/1:B/1:C 3luq/1/1:D/1:A
Other dimers with similar sequences but different poses	3luq/2/1:A/1:B 3luq/1/1:A/1:B 3luq/1/1:D/1:C