3lxf/1/1:C/2:E

Sequences
>3lxf-a1-m1-cC (length=104) [Search sequence]
TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRL
PALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED
>3lxf-a1-m2-cE (length=104) [Search sequence]
TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRL
PALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED
Structure information
PDB ID 3lxf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of [2Fe-2S] Ferredoxin Arx from Novosphingobium aromaticivorans
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
PubMed citation 20576606
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C E
UniProt accession Q2G8A3 Q2G8A3
Species 279238 (Novosphingobium aromaticivorans DSM 12444) 279238 (Novosphingobium aromaticivorans DSM 12444)
Function annotation BioLiP:3lxfC BioLiP:3lxfE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3lxf-a1-m1-cC_3lxf-a1-m2-cE.pdb.gz
Full biological assembly
Download: 3lxf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3lxf/1/1:A/2:A 3lxf/1/1:B/2:D 3lxf/1/1:D/2:B 3lxf/1/1:E/2:C
Other dimers with similar sequences but different poses
  • 3lxf/1/2:D/2:E 3lxf/1/1:A/1:B 3lxf/1/1:A/1:D 3lxf/1/1:B/1:C 3lxf/1/1:C/1:E 3lxf/1/1:D/1:E 3lxf/1/2:A/2:B 3lxf/1/2:A/2:D 3lxf/1/2:B/2:C 3lxf/1/2:C/2:E
  • 3lxf/1/1:E/2:E 3lxf/1/1:A/2:B 3lxf/1/1:B/2:A 3lxf/1/1:C/2:D 3lxf/1/1:D/2:C
  • [Back to Home]