3lxf/1/2:D/2:E

Sequences

>3lxf-a1-m2-cD (length=104) [Search sequence]

TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRL PALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED

>3lxf-a1-m2-cE (length=104) [Search sequence]

TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRL PALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED

Structure information

PDB ID	3lxf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of [2Fe-2S] Ferredoxin Arx from Novosphingobium aromaticivorans
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	30
Sequence identity between the two chains	1.0
PubMed citation	20576606

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	D	E
UniProt accession	Q2G8A3	Q2G8A3
Species	279238 (Novosphingobium aromaticivorans DSM 12444)	279238 (Novosphingobium aromaticivorans DSM 12444)
Function annotation	BioLiP:3lxfD	BioLiP:3lxfE

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3lxf-a1-m2-cD_3lxf-a1-m2-cE.pdb.gz

Full biological assembly Download: 3lxf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3lxf/1/1:A/1:B 3lxf/1/1:A/1:D 3lxf/1/1:B/1:C 3lxf/1/1:C/1:E 3lxf/1/1:D/1:E 3lxf/1/2:A/2:B 3lxf/1/2:A/2:D 3lxf/1/2:B/2:C 3lxf/1/2:C/2:E
Other dimers with similar sequences but different poses	3lxf/1/1:C/2:E 3lxf/1/1:A/2:A 3lxf/1/1:B/2:D 3lxf/1/1:D/2:B 3lxf/1/1:E/2:C 3lxf/1/1:E/2:E 3lxf/1/1:A/2:B 3lxf/1/1:B/2:A 3lxf/1/1:C/2:D 3lxf/1/1:D/2:C