3lyv/4/1:B/3:A

Sequences
>3lyv-a4-m1-cB (length=56) [Search sequence]
QVVRTKNVTLKPDVEEARLQELLGHDFFIYTDSEDGATNILYRREDGNLGLIEAKL
>3lyv-a4-m3-cA (length=57) [Search sequence]
QVVRTKNVTLKPDVEEARLQELLGHDFFIYTDSEDGATNILYRREDGNLGLIEAKLE
Structure information
PDB ID 3lyv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a domain of ribosome-associated factor Y from streptococcus pyogenes serotype M6. Northeast Structural Genomics Consortium target id DR64A
Assembly ID 4
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 74
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B A
UniProt accession Q5XAQ7 Q5XAQ7
Species 301450 (Streptococcus pyogenes serotype M6) 301450 (Streptococcus pyogenes serotype M6)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3lyv-a4-m1-cB_3lyv-a4-m3-cA.pdb.gz
Full biological assembly
Download: 3lyv-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3lyv/1/2:B/1:A 3lyv/2/1:F/1:C

[Back to Home]