3m05/1/1:C/1:B

Sequences
>3m05-a1-m1-cC (length=96) [Search sequence]
ATKLVIAIVQDKDANYLSDQFIDQNVRATKLSTTGGFLQSGNTTFIGIEEERVPEVLEII
KKASHTREEFTPSYPIKVQVGGATVLVLPVDQFERF
>3m05-a1-m1-cB (length=97) [Search sequence]
AATKLVIAIVQDKDANYLSDQFIDQNVRATKLSTTGGFLQSGNTTFIGIEEERVPEVLEI
IKKASHTREEFTPSYPIKVQVGGATVLVLPVDQFERF
Structure information
PDB ID 3m05 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of a functionally unknown protein PEPE_1480 from Pediococcus pentosaceus ATCC 25745
Assembly ID 1
Resolution 3.145Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession Q03E61 Q03E61
Species 278197 (Pediococcus pentosaceus ATCC 25745) 278197 (Pediococcus pentosaceus ATCC 25745)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3m05-a1-m1-cC_3m05-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3m05-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3m05/1/1:A/1:B 3m05/1/1:A/1:C
Other dimers with similar sequences but different poses
  • 3m05/3/3:C/1:B 3m05/2/1:A/2:A
  • [Back to Home]