3m4c/1/2:E/3:D

Sequences
>3m4c-a1-m2-cE (length=9) [Search sequence]
KTTCNACHQ
>3m4c-a1-m3-cD (length=106) [Search sequence]
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHD
FRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Structure information
PDB ID 3m4c (database links: RCSB PDB PDBe PDBj PDBsum)
Title A Zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
PubMed citation 20721993
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID E D
UniProt accession P0ABE7
Species 32630 (synthetic construct) 562 (Escherichia coli)
Function annotation BioLiP:3m4cD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3m4c-a1-m2-cE_3m4c-a1-m3-cD.pdb.gz
Full biological assembly
Download: 3m4c-assembly1.cif.gz
Similar dimers

[Back to Home]