3m86/3/2:B/2:A

Sequences
>3m86-a3-m2-cB (length=104) [Search sequence]
GPHMAIHILTEKEDHATLHISFNDLIKIQLRTNPSTGYAWNIEYPTDTFSLSQDTIKAEP
FPSIREIQLKPLKVGTTTIKLGYSRPWEKGKEPLRSLTYSVVIR
>3m86-a3-m2-cA (length=111) [Search sequence]
GPHMAIHILTEKEDHATLHISFNDLIKIQLRTNPSTGYAWNIEYPTDTFSLSQDTIKAEP
HPSGMVGFPSIREIQLKPLKVGTTTIKLGYSRPWEKGKEPLRSLTYSVVIR
Structure information
PDB ID 3m86 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the cysteine protease inhibitor, EhICP2, from Entamoeba histolytica
Assembly ID 3
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession C4M2H5 C4M2H5
Species 294381 (Entamoeba histolytica HM-1:IMSS) 294381 (Entamoeba histolytica HM-1:IMSS)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3m86-a3-m2-cB_3m86-a3-m2-cA.pdb.gz
Full biological assembly
Download: 3m86-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3m86/3/1:B/2:B 3m86/3/1:A/2:A
  • 3m86/3/2:B/1:A 3m86/3/1:B/2:A
  • [Back to Home]