3may/2/1:E/1:G

Sequences

>3may-a2-m1-cE (length=94) [Search sequence]

DPCAASEVARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVA SDLHALSQPLTDLSTRCSLPISGLQAIGLMQAVQ

>3may-a2-m1-cG (length=97) [Search sequence]

PCAASEVARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVAS DLHALSQPLTDLSTRCSLPISGLQAIGLMQAVQGARR

Structure information

PDB ID	3may (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a secreted Mycobacterium tuberculosis heme-binding protein
Assembly ID	2
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	41
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	G
UniProt accession	O53654	O53654
Species	1773 (Mycobacterium tuberculosis)	1773 (Mycobacterium tuberculosis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3may-a2-m1-cE_3may-a2-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3may-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3may/2/1:H/1:G 3may/1/1:A/1:B 3may/1/1:D/1:C 3may/2/1:F/1:E 3may/2/1:E/1:H 3may/1/1:B/1:D