3may/2/1:H/1:G

Sequences
>3may-a2-m1-cH (length=96) [Search sequence]
DPCAASEVARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVA
SDLHALSQPLTDLSTRCSLPISGLQAIGLMQAVQGA
>3may-a2-m1-cG (length=97) [Search sequence]
PCAASEVARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVAS
DLHALSQPLTDLSTRCSLPISGLQAIGLMQAVQGARR
Structure information
PDB ID 3may (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a secreted Mycobacterium tuberculosis heme-binding protein
Assembly ID 2
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 147
Sequence identity between the two chains 0.99
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H G
UniProt accession O53654 O53654
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3may-a2-m1-cH_3may-a2-m1-cG.pdb.gz
Full biological assembly
Download: 3may-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3may/1/1:A/1:B 3may/1/1:D/1:C 3may/2/1:F/1:E
Other dimers with similar sequences but different poses
  • 3may/2/1:E/1:G 3may/1/1:B/1:C
  • 3may/2/1:E/1:H 3may/1/1:B/1:D
  • [Back to Home]