3mb2/1/1:F/1:D

Sequences

>3mb2-a1-m1-cF (length=54) [Search sequence]

PMLEVFYSGDRPPDRTRKQAFAAEASAIFQRVIGTPPGRLQLIIQIVSPENTLA

>3mb2-a1-m1-cD (length=58) [Search sequence]

PMLEVFYSGDRPPDRTRKQAFAAEASAIFQRVIGTPPGRLQLIIQIVSPENTLAVIDL

Structure information

PDB ID	3mb2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Kinetic and Structural Characterization of a Heterohexamer 4-Oxalocrotonate Tautomerase from Chloroflexus aurantiacus J-10-fl: Implications for Functional and Structural Diversity in the Tautomerase Superfamily
Assembly ID	1
Resolution	2.41Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	30
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	D
UniProt accession	A9W9V0	A9W9V0
Species	324602 (Chloroflexus aurantiacus J-10-fl)	324602 (Chloroflexus aurantiacus J-10-fl)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3mb2-a1-m1-cF_3mb2-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3mb2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3mb2/1/1:D/1:B 3mb2/1/1:F/1:B 3mb2/2/1:H/1:J 3mb2/2/1:L/1:H 3mb2/2/1:L/1:J