3mbh/1/1:A/1:F

Sequences

>3mbh-a1-m1-cA (length=279) [Search sequence]

YANKVKKIAAVHDLSGGRVSLTVVIPILSSGFQVCPLPTAVLSNHTQYPGFSFLDLTDEP
KIIAEWKKLEVQFDAIYTGYLGSPRQIQIVSDFIKDFRQPDSLIVADPVLGDNGRLYTNF
DEVKERHLITKADVITPNLTELFYLLDEPYKADSTDEELKEYLRLLSDKGPQVVIITSVP
VHDEPHKTSVYAYNRQGNRYWKVTCPYLPAHYPGTGDTFTSVITGSLQGDSLPALDRATQ
FILQGIRATFGYEYDNREGILLEKVLHNLDPIQASYELI

>3mbh-a1-m1-cF (length=279) [Search sequence]

Structure information

PDB ID	3mbh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a putative phosphomethylpyrimidine kinase (BT_4458) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.00 A resolution (orthorhombic form with pyridoxal)
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	25
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	F
UniProt accession	Q89ZB9	Q89ZB9
Species	226186 (Bacteroides thetaiotaomicron VPI-5482)	226186 (Bacteroides thetaiotaomicron VPI-5482)
Function annotation	BioLiP:3mbhA	BioLiP:3mbhF

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3mbh-a1-m1-cA_3mbh-a1-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3mbh-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3mbh/1/1:D/1:F 3mbh/1/1:A/1:C 3mbh/1/1:B/1:E 3mbj/1/1:A/6:A 3mbj/1/2:A/5:A 3mbj/1/3:A/4:A

3mbj/1/5:A/6:A 3mbh/1/1:A/1:E 3mbh/1/1:B/1:C 3mbh/1/1:B/1:F 3mbh/1/1:C/1:F 3mbh/1/1:D/1:A 3mbh/1/1:D/1:E 3mbj/1/1:A/2:A 3mbj/1/1:A/3:A 3mbj/1/2:A/3:A 3mbj/1/4:A/5:A 3mbj/1/4:A/6:A