3mce/2/1:D/1:C

Sequences

>3mce-a2-m1-cD (length=57) [Search sequence]

SPEFSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQ

>3mce-a2-m1-cC (length=59) [Search sequence]

PLGSPEFSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLS

Structure information

PDB ID	3mce (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the NAC domain of alpha subunit of nascent polypeptide-associated complex(NAC)
Assembly ID	2
Resolution	2.396Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	0.982

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q13765	Q13765
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3mce-a2-m1-cD_3mce-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3mce-assembly2.cif.gz

Similar dimers