3mfx/2/1:C/2:C

Sequences
>3mfx-a2-m1-cC (length=108) [Search sequence]
SSLETIELFIQHLTEAILVNANGFIRSCNQRSAELLDCPQVSLKGQDWRNFLTEHHQARY
DNLLSHDGQPVQHPAQETTLICASGKAKDVELSISYIPGHEPFVVHDL
>3mfx-a2-m2-cC (length=108) [Search sequence]
SSLETIELFIQHLTEAILVNANGFIRSCNQRSAELLDCPQVSLKGQDWRNFLTEHHQARY
DNLLSHDGQPVQHPAQETTLICASGKAKDVELSISYIPGHEPFVVHDL
Structure information
PDB ID 3mfx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the sensory box domain of the sensory-box/GGDEF protein SO_1695 from Shewanella oneidensis, Northeast Structural Genomics Consortium Target SoR288B
Assembly ID 2
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession Q8EGB0 Q8EGB0
Species 70863 (Shewanella oneidensis) 70863 (Shewanella oneidensis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3mfx-a2-m1-cC_3mfx-a2-m2-cC.pdb.gz
Full biological assembly
Download: 3mfx-assembly2.cif.gz
Similar dimers

[Back to Home]