3mhx/1/1:B/1:A

Sequences
>3mhx-a1-m1-cB (length=81) [Search sequence]
AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGEPLLVQVGFTRF
ALRISEAKRVVVDAASQERRA
>3mhx-a1-m1-cA (length=85) [Search sequence]
AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGPVGGEPLLVQVG
FTRFALRISEAKRVVVDAASQERRA
Structure information
PDB ID 3mhx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Stenotrophomonas maltophilia FeoA complexed with Zinc: A Unique Procaryotic SH3 Domain Protein Possibly Acting as a Bacterial Ferrous Iron Transport Activating Factor
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation 20516589
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession B2FQ63 B2FQ63
Species 522373 (Stenotrophomonas maltophilia K279a) 522373 (Stenotrophomonas maltophilia K279a)
Function annotation BioLiP:3mhxB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3mhx-a1-m1-cB_3mhx-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3mhx-assembly1.cif.gz

[Back to Home]