3mjg/2/1:A/1:B

Sequences
>3mjg-a2-m1-cA (length=97) [Search sequence]
TIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQV
QLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETV
>3mjg-a2-m1-cB (length=101) [Search sequence]
LGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCR
PTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETV
Structure information
PDB ID 3mjg (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of a platelet derived growth factor receptor complex
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P01127 P01127
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3mjg-a2-m1-cA_3mjg-a2-m1-cB.pdb.gz
Full biological assembly
Download: 3mjg-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3mjg/1/1:A/1:B 4hqu/1/1:A/2:A 4hqx/1/1:A/2:A 6t9e/1/1:CCC/1:DDD

[Back to Home]