3mki/3/2:C/2:D

Sequences
>3mki-a3-m2-cC (length=124) [Search sequence]
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEEPVGSEPRSGTAAIREFYANSLK
LPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKN
IHAG
>3mki-a3-m2-cD (length=124) [Search sequence]
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEEPVGSEPRSGTAAIREFYANSLK
LPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKN
IHAG
Structure information
PDB ID 3mki (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Ketosteroid Isomerase D38ED99N from Pseudomonas Testosteroni (tKSI)
Assembly ID 3
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 85
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID C D
UniProt accession P00947 P00947
Species 285 (Comamonas testosteroni) 285 (Comamonas testosteroni)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3mki-a3-m2-cC_3mki-a3-m2-cD.pdb.gz
Full biological assembly
Download: 3mki-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1buq/1/1:A/1:B 1isk/1/1:A/1:B 1ocv/1/1:A/1:B 1ocv/2/1:C/1:D 1ogz/1/1:A/2:A 1ohp/1/1:A/1:B 1ohp/2/1:C/1:D 1ohs/1/1:A/1:B 1ohs/2/1:C/1:D 1qjg/1/1:C/1:D 1qjg/2/1:A/1:B 1qjg/3/1:E/1:F 3m8c/1/1:A/1:B 3m8c/2/1:C/1:D 3mhe/1/1:A/1:B 3mki/1/1:A/1:B 3mki/2/1:C/1:D 3mki/3/1:A/1:B 3mki/3/1:C/1:D 3mki/3/2:A/2:B 3myt/1/1:A/1:C 3myt/2/1:D/1:B 3myt/3/1:A/1:C 3myt/3/1:D/1:B 3myt/3/2:A/2:C 3myt/3/2:D/2:B 3myt/4/1:D/1:B 3myt/4/2:A/2:C 3nbr/1/1:A/2:A 3nhx/1/1:A/2:A 3nm2/1/1:A/2:A 3nuv/1/1:B/1:A 3nuv/2/1:B/1:A 3nuv/2/2:B/2:A 3nxj/1/1:A/1:B 3nxj/2/1:A/1:B 3nxj/2/2:A/2:B 3ov4/1/1:A/1:B 3ov4/2/1:C/1:D 3t8u/1/1:A/1:B 3t8u/2/1:C/1:D 3unl/1/1:A/1:B 3unl/2/1:C/1:D 4l7k/1/1:A/1:B 4l7k/2/1:J/1:C 4l7k/3/1:D/1:I 4l7k/4/1:E/1:G 4l7k/5/1:K/1:F 4l7k/6/1:O/1:H 5dre/1/1:A/2:A 5ugi/1/1:A/2:A 8cho/1/1:A/2:A
Other dimers with similar sequences but different poses
  • 3myt/3/1:D/2:D 3mki/3/1:A/2:A
  • 3myt/4/1:B/2:C 3mki/3/1:B/1:D 3mki/3/2:B/2:D 3myt/3/1:B/2:C 3myt/3/1:C/2:B
  • 3myt/3/1:B/2:B 3mki/3/1:B/2:B
  • 3nuv/2/2:B/1:A 3nuv/2/1:B/2:A 3nxj/2/1:A/2:B 3nxj/2/1:B/2:A
  • 3nuv/2/1:B/2:B 3nxj/2/1:A/2:A
  • [Back to Home]