3mlf/1/1:B/1:A

Sequences
>3mlf-a1-m1-cB (length=89) [Search sequence]
NLYFQSNAKTLKELRTDYGLTQKELGDLFKVSSRTIQNEKDSTNIKDSLLSKYSAFNVKY
DDIFLGNEYENFVFTNDKKKSIILAFKEK
>3mlf-a1-m1-cA (length=92) [Search sequence]
TENLYFQSNAKTLKELRTDYGLTQKELGDLFKVSSRTIQNEKDSTNIKDSLLSKYSAFNV
KYDDIFLGNEYENFVFTNDKKKSIILAFKEKQ
Structure information
PDB ID 3mlf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Putative transcriptional regulator from Staphylococcus aureus.
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 54
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession
Species 451516 (Staphylococcus aureus subsp. aureus USA300_TCH1516) 451516 (Staphylococcus aureus subsp. aureus USA300_TCH1516)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3mlf-a1-m1-cB_3mlf-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3mlf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3mlf/2/1:C/1:D 3mlf/3/1:E/2:E

[Back to Home]