3mlf/1/1:B/1:A

Sequences

>3mlf-a1-m1-cB (length=89) [Search sequence]

NLYFQSNAKTLKELRTDYGLTQKELGDLFKVSSRTIQNEKDSTNIKDSLLSKYSAFNVKY DDIFLGNEYENFVFTNDKKKSIILAFKEK

>3mlf-a1-m1-cA (length=92) [Search sequence]

TENLYFQSNAKTLKELRTDYGLTQKELGDLFKVSSRTIQNEKDSTNIKDSLLSKYSAFNV KYDDIFLGNEYENFVFTNDKKKSIILAFKEKQ

Structure information

PDB ID	3mlf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Putative transcriptional regulator from Staphylococcus aureus.
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	54
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession
Species	451516 (Staphylococcus aureus subsp. aureus USA300_TCH1516)	451516 (Staphylococcus aureus subsp. aureus USA300_TCH1516)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3mlf-a1-m1-cB_3mlf-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3mlf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3mlf/2/1:C/1:D 3mlf/3/1:E/2:E