3mop/1/1:B/1:E

Sequences
>3mop-a1-m1-cB (length=105) [Search sequence]
MLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAW
QGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYIAAALEH
>3mop-a1-m1-cE (length=105) [Search sequence]
MLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAW
QGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYIAAALEH
Structure information
PDB ID 3mop (database links: RCSB PDB PDBe PDBj PDBsum)
Title The ternary Death Domain complex of MyD88, IRAK4, and IRAK2
Assembly ID 1
Resolution 3.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B E
UniProt accession Q99836 Q99836
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3mop-a1-m1-cB_3mop-a1-m1-cE.pdb.gz
Full biological assembly
Download: 3mop-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3mop/1/1:A/1:D 3mop/1/1:C/1:F 6i3n/1/1:A/1:D 6i3n/1/1:B/1:E 6i3n/1/1:C/1:F 6i3n/1/1:D/1:G 6i3n/1/1:E/1:H 6i3n/1/1:F/1:I 6i3n/1/1:G/1:J 6i3n/1/1:H/1:K 6i3n/1/1:I/1:L 6i3n/1/1:J/1:M
Other dimers with similar sequences but different poses
  • 3mop/1/1:E/1:F 3mop/1/1:A/1:B 3mop/1/1:B/1:C 3mop/1/1:C/1:D 3mop/1/1:D/1:E 6i3n/1/1:A/1:B 6i3n/1/1:B/1:C 6i3n/1/1:C/1:D 6i3n/1/1:D/1:E 6i3n/1/1:E/1:F 6i3n/1/1:F/1:G 6i3n/1/1:G/1:H 6i3n/1/1:H/1:I 6i3n/1/1:I/1:J 6i3n/1/1:J/1:K 6i3n/1/1:K/1:L 6i3n/1/1:L/1:M
  • 3mop/1/1:B/1:F 3mop/1/1:A/1:E 6i3n/1/1:A/1:E 6i3n/1/1:B/1:F 6i3n/1/1:C/1:G 6i3n/1/1:D/1:H 6i3n/1/1:E/1:I 6i3n/1/1:F/1:J 6i3n/1/1:G/1:K 6i3n/1/1:H/1:L 6i3n/1/1:I/1:M
  • [Back to Home]