3mop/1/1:M/1:N

Sequences
>3mop-a1-m1-cM (length=93) [Search sequence]
ACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMEWVQGVSITRELL
WWWGMRQATVQQLVDLLCRLELYRAAQIILNWK
>3mop-a1-m1-cN (length=93) [Search sequence]
ACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMEWVQGVSITRELL
WWWGMRQATVQQLVDLLCRLELYRAAQIILNWK
Structure information
PDB ID 3mop (database links: RCSB PDB PDBe PDBj PDBsum)
Title The ternary Death Domain complex of MyD88, IRAK4, and IRAK2
Assembly ID 1
Resolution 3.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID M N
UniProt accession O43187 O43187
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3mop-a1-m1-cM_3mop-a1-m1-cN.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3mop-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3mop/1/1:K/1:L 3mop/1/1:L/1:M

[Back to Home]