3mqb/2/3:B/3:A

Sequences
>3mqb-a2-m3-cB (length=106) [Search sequence]
SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQG
QKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYP
>3mqb-a2-m3-cA (length=109) [Search sequence]
SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQG
QKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQ
Structure information
PDB ID 3mqb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Ectodomain of BST-2/Tetherin/CD317 (C2)
Assembly ID 2
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 105
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID B A
UniProt accession Q10589 Q10589
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3mqb-a2-m3-cB_3mqb-a2-m3-cA.pdb.gz
Full biological assembly
Download: 3mqb-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2x7a/1/1:A/1:B 2x7a/2/1:C/1:D 2x7a/3/1:E/1:F 2x7a/4/1:G/1:H 2x7a/5/1:I/1:J 2xg7/1/1:C/1:A 3mqb/1/1:B/1:A 3mqb/1/2:F/2:E 3mqb/2/1:B/1:A 3mqb/3/1:F/1:E 3mqb/3/4:F/4:E 3mqc/1/1:A/1:B 3mqc/1/1:C/1:D 3nwh/1/1:C/1:A 3nwh/1/1:D/1:B
Other dimers with similar sequences but different poses
  • 3mqc/2/2:B/2:D 3mqb/2/1:A/3:A 3mqc/1/1:B/1:D 3nwh/1/1:A/1:B
  • 3mqb/2/3:B/1:A 3mqb/2/1:B/3:A 3mqb/3/1:E/4:E 3mqb/3/1:F/4:F 3mqc/1/1:A/1:D 3mqc/1/1:B/1:C 3nwh/1/1:C/1:B 3nwh/1/1:D/1:A
  • 3mqb/3/4:F/1:E 3mqb/2/1:B/3:B 3mqb/3/1:F/4:E
  • 3mqc/2/1:A/1:C 3mqc/1/1:A/1:C 3nwh/1/1:D/1:C
  • 3mqc/2/1:C/2:D 3mqc/2/1:A/2:B
  • [Back to Home]