3mqi/2/1:C/2:C

Sequences
>3mqi-a2-m1-cC (length=89) [Search sequence]
HATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRH
IPGVVEVTLSYKSKQFCKGTPGRFIYTAL
>3mqi-a2-m2-cC (length=89) [Search sequence]
HATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRH
IPGVVEVTLSYKSKQFCKGTPGRFIYTAL
Structure information
PDB ID 3mqi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human early B-cell factor 1 (EBF1) IPT/TIG domain
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession Q9UH73 Q9UH73
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3mqi-a2-m1-cC_3mqi-a2-m2-cC.pdb.gz
Full biological assembly
Download: 3mqi-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3mln/1/1:A/1:B 3mlo/1/1:A/1:B 3mlp/2/1:F/1:E
  • [Back to Home]