3mup/1/1:B/1:D

Sequences

>3mup-a1-m1-cB (length=100) [Search sequence]

ISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGD DPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL

>3mup-a1-m1-cD (length=102) [Search sequence]

SISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESG DDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLS

Structure information

PDB ID	3mup (database links: RCSB PDB PDBe PDBj PDBsum)
Title	cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac037
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	19
Sequence identity between the two chains	1.0
PubMed citation	20954235

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q13490	Q13490
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3mupB	BioLiP:3mupD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3mup-a1-m1-cB_3mup-a1-m1-cD.pdb.gz

Full biological assembly Download: 3mup-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3mup/1/1:A/1:C 4eb9/1/1:A/1:C 4eb9/2/1:B/1:D
Other dimers with similar sequences but different poses	3mup/1/1:D/1:C 3mup/1/1:B/1:A