3n01/1/1:B/1:A

Sequences

>3n01-a1-m1-cB (length=84) [Search sequence]

EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNLSLADVTQ QAGLVKSELEAQTGLQILQTGVGQ

>3n01-a1-m1-cA (length=87) [Search sequence]

EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLAD VTQQAGLVKSELEAQTGLQILQTGVGQ

Structure information

PDB ID	3n01 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of an abridged form of the mature ectodomain of the Human Receptor-Type Protein Tyrosine Phosphatase ICA512/IA-2 at pH 8.5
Assembly ID	1
Resolution	1.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	39
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q16849	Q16849
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3n01B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3n01-a1-m1-cB_3n01-a1-m1-cA.pdb.gz

Full biological assembly Download: 3n01-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2qt7/1/1:A/1:B 2qt7/1/2:A/2:B 2qt7/2/1:A/1:B 3n4w/1/1:B/1:A 3ng8/1/1:A/1:B
Other dimers with similar sequences but different poses	3n01/2/1:B/2:A 2qt7/1/1:A/2:B 3n4w/2/2:B/1:A 3ng8/2/1:B/2:A 3np5/2/1:A/2:C 3np5/3/1:B/3:D 3np5/1/1:C/1:D 3np5/1/1:A/1:B 3np5/1/1:B/1:D 3np5/1/1:A/1:C