3n01/2/1:B/2:A

Sequences
>3n01-a2-m1-cB (length=84) [Search sequence]
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNLSLADVTQ
QAGLVKSELEAQTGLQILQTGVGQ
>3n01-a2-m2-cA (length=87) [Search sequence]
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLAD
VTQQAGLVKSELEAQTGLQILQTGVGQ
Structure information
PDB ID 3n01 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of an abridged form of the mature ectodomain of the Human Receptor-Type Protein Tyrosine Phosphatase ICA512/IA-2 at pH 8.5
Assembly ID 2
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B A
UniProt accession Q16849 Q16849
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3n01B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3n01-a2-m1-cB_3n01-a2-m2-cA.pdb.gz
Full biological assembly
Download: 3n01-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2qt7/1/1:A/2:B 3n4w/2/2:B/1:A 3ng8/2/1:B/2:A 3np5/2/1:A/2:C 3np5/3/1:B/3:D
Other dimers with similar sequences but different poses
  • 3n01/1/1:B/1:A 2qt7/1/1:A/1:B 2qt7/1/2:A/2:B 2qt7/2/1:A/1:B 3n4w/1/1:B/1:A 3ng8/1/1:A/1:B
  • 3np5/1/1:C/1:D 3np5/1/1:A/1:B
  • 3np5/1/1:B/1:D 3np5/1/1:A/1:C
  • [Back to Home]